- UBE2F/NCE2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92169
- PBS (pH 7.2) and 40% Glycerol
- 0.1 ml
- This antibody was developed against Recombinant Protein corresponding to amino acids: AYNMVPPKVK CLTKIWHPNI TETGEICLSL LREHSIDGTG WAPTRTLKDV VWGLNSLFTD LLNFDDPLNI EAAEHHLRDK EDFRNKVDDY
- Human
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- UBE2F/NCE2
- NCE2
- Unconjugated
- Rabbit
- ubiquitin conjugating enzyme E2 F (putative)
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
AYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDY
Specifications/Features
Available conjugates: Unconjugated